PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang05g09750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family CO-like
Protein Properties Length: 331aa    MW: 36531.6 Da    PI: 8.7459
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang05g09750.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box27.18.6e-09446440
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                    + C+ +++  ++l+C+ +  +lC  C ++ H        H +v
  Vang05g09750.1  4 KLCDSCKSATATLYCRPDAAFLCGACDSKVHAAnklasrHPRV 46
                    68*****************************656666667665 PP

2zf-B_box22.42.6e-074790441
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                      C+ +e+ +++  C+ +   lC  C   +H+       H++ p
  Vang05g09750.1 47 ALCEVCEQAPAHVTCKADAAALCLACDRDIHSAnplasrHERLP 90
                    68*****************************6688888898876 PP

3CCT70.73.8e-24234277144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Vang05g09750.1 234 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRS 277
                     9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.665148IPR000315B-box-type zinc finger
SMARTSM003361.1E-13148IPR000315B-box-type zinc finger
PfamPF006434.1E-7446IPR000315B-box-type zinc finger
CDDcd000216.81E-9548No hitNo description
PROSITE profilePS5011910.6234491IPR000315B-box-type zinc finger
PfamPF006437.3E-64791IPR000315B-box-type zinc finger
SMARTSM003365.5E-94991IPR000315B-box-type zinc finger
PROSITE profilePS5101716.787234276IPR010402CCT domain
PfamPF062034.8E-18234276IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MASKLCDSCK SATATLYCRP DAAFLCGACD SKVHAANKLA SRHPRVALCE VCEQAPAHVT  60
CKADAAALCL ACDRDIHSAN PLASRHERLP VAPFYESVHS VKASSPINFL DDHRFFSDAD  120
ADVSTEEAEA ASWLLPNPKT DLNSSQYLFS ESEPVPYIDL DYAVADPKAD PKGSATADGV  180
VPVQSNYEPF AYGYKYNSTT LSQSQSQMSQ SISNCSYSKV AAVTVTAQFS AADREARVLR  240
YREKRKNRKF EKTIRYASRK AYAETRPRIK GRFAKRSDAD PLAGYGVVKK EAKETMMAIA  300
LPFRLMLLCR VSQIKFWKTI GIEHVIKRFL *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014502470.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T91e-107COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLU5TZJ50.0U5TZJ5_PHAVU; Constans
STRINGGLYMA04G06240.11e-176(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13023493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.19e-95CONSTANS-like 4